現貨供應，歡迎訂購: : B-type Natriuretic Peptide Human Recombinant 2µg
10µg
1mg | Catalogue Number | CYT-327 | | Synonyms | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. | | Introduction | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. | | Description | B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
NPPB is purified by proprietary chromatographic techniques. | | Source | Escherichia Coli. | | Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | | Formulation | Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride. | | Solubility | It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. | | Stability | Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles. | | Purity | Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE. | | Amino acid sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. | | Usage | Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. | | Related Products | |
Related Products Activin A cyt-569 Hystemcell.cn Recombinant Human Activin-A Activin A Plant-Active cyt-414 Hystemcell.cn Recombinant Human Activin-A Active Activin A HEK-Active cyt-078 Hystemcell.cn Recombinant Human Activin-A HEK-Active Activin A Plant cyt-052 Hystemcell.cn Recombinant Human Activin-A, Plant Activin B Active cyt-057 Hystemcell.cn Recombinant Human Activin-B Active Activin B cyt-058 Hystemcell.cn Recombinant Human Activin-B Activin A, Active cyt-145 Hystemcell.cn Recombinant Human Activin-A, Active mActivin A cyt-146 Hystemcell.cn Recombinant Mouse Activin-A rActivin A cyt-147 Hystemcell.cn Recombinant Rat Activin-A Acrp30 cyt-024 Human Adiponectin Acrp30 cyt-280 Hystemcell.cn Recombinant Human Adiponectin Acrp30 His cyt-433 Hystemcell.cn Recombinant Human Adiponectin, His tag mAcrp30 His cyt-537 Hystemcell.cn Recombinant Mouse Adiponectin, His tag Acrp30 HEK cyt-434 Hystemcell.cn Recombinant Human Adiponectin glycosilated, HEK mAcrp30 HEK cyt-435 Hystemcell.cn Recombinant Mouse Adiponectin glycosilated, HEK pAcrp30 HEK cyt-696 Hystemcell.cn Recombinant Porcine Adiponectin glycosilated, HEK Acrp30 Tri cyt-233 Hystemcell.cn Recombinant Human Adiponectin Trimeric Form mAcrp30 Tri cyt-247 Hystemcell.cn Recombinant Mouse Adiponectin Trimeric Form gAcrp30 cyt-615 Hystemcell.cn Recombinant Human Adiponectin Globular gAcrp30 His cyt-277 Hystemcell.cn Recombinant Human Adiponectin Globular, His tag mgAcrp30 cyt-432 Hystemcell.cn Recombinant Mouse Adiponectin Globular AIF1 cyt-697 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1 AIF1L cyt-007 Hystemcell.cn Recombinant Human Allograft Inflammatory Factor 1 Like AITRL cyt-076 Hystemcell.cn Recombinant Human AITRL AITRL His cyt-317 Hystemcell.cn Recombinant Human AITRL, His Tag ANGPT1 cyt-074 Hystemcell.cn Recombinant Human Angiopoietin-1 ANGPTL3 cyt-248 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 3 ANGPTL4 cyt-249 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4 ANGPTL4 HEK cyt-698 Hystemcell.cn Recombinant Human Angiopoietin-like Protein 4, HEK APOA1 cyt-661 Hystemcell.cn Recombinant Human Apolipoprotein A-I APOA1 cyt-037 Human Apolipoprotein A-I APOA2 cyt-038 Human Apolipoprotein A-II APOA5 cyt-025 Hystemcell.cn Recombinant Human Apolipoprotein A-V AREG cyt-041 Hystemcell.cn Recombinant Human Amphiregulin Clusterin cyt-278 Hystemcell.cn Recombinant Human Apoliprotein-J Clusterin cyt-548 Human Apoliprotein-J rClusterin cyt-437 Hystemcell.cn Recombinant Rat Apoliprotein-J k9Clusterin cyt-549 Hystemcell.cn Recombinant Canine Apoliprotein-J k9Clusterin HEK cyt-618 Hystemcell.cn Recombinant Canine Apoliprotein-J HEK APO D cyt-547 Hystemcell.cn Recombinant Human Apoliprotein-D APO D GST cyt-652 Hystemcell.cn Recombinant Human APO-D GST Tag APOH cyt-189 Hystemcell.cn Recombinant Human Apoliprotein-H APOM cyt-715 Hystemcell.cn Recombinant Human Apolipoprotein-M APOM HEK cyt-026 Hystemcell.cn Recombinant Human Apolipoprotein-M, HEK Artemin cyt-306 Hystemcell.cn Recombinant Human Artemin BD 1 cyt-564 Hystemcell.cn Recombinant Human Beta Defensin -1 mBD 1 cyt-044 Hystemcell.cn Recombinant Mouse Beta Defensin -1 rBD 1 cyt-062 Hystemcell.cn Recombinant Rat Beta Defensin -1 BD 2 cyt-571 Hystemcell.cn Recombinant Human Beta Defensin -2 mBD 2 cyt-035 Hystemcell.cn Recombinant Mouse Beta Defensin -2 BD 3 cyt-461 Hystemcell.cn Recombinant Human Beta Defensin -3 mBD 3 cyt-036 Hystemcell.cn Recombinant Mouse Beta Defensin -3 rBD 3 cyt-063 Hystemcell.cn Recombinant Rat Beta Defensin -3 BD 4 cyt-599 Hystemcell.cn Recombinant Human Beta Defensin -4 rBD 4 cyt-066 Hystemcell.cn Recombinant Rat Beta Defensin -4 BDNF cyt-207 Hystemcell.cn Recombinant Human Brain-Derived Neurotrophic Factor proBDNF cyt-014 Hystemcell.cn Recombinant Human Precursor Brain-Derived Neurotrophic Factor BAFF cyt-307 Hystemcell.cn Recombinant Human BAFF (BLyS) BAFF His cyt-545 Hystemcell.cn Recombinant Human BAFF (BLyS), His Tag BAFF Plant cyt-054 Hystemcell.cn Recombinant Human BAFF (BLyS), Plant BAFF R cyt-429 Hystemcell.cn Recombinant Human BAFF (BLyS) Receptor BMPR1A cyt-380 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A BMPR1A HEK cyt-713 Hystemcell.cn Recombinant Human Bone Morphogenetic protein Receptor-1A HEK BMP 2 cyt-261 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2 BMP 2 HEK cyt-080 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2, HEK BMP 2 Mono cyt-627 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-2 Monomer Pro BMP 2 cyt-427 Hystemcell.cn Recombinant Human Pro Bone Morphogenetic protein-2 BMP 4 cyt-361 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4 BMP 4 Active cyt-081 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-4 Active BMP 5 cyt-660 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-5 BMP 7 cyt-333 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7 BMP 7 His cyt-629 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7 His Tag BMP 7 CHO cyt-276 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, CHO BMP 7 Plant cyt-039 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, Plant BMP 7 HEK cyt-082 Hystemcell.cn Recombinant Human Bone Morphogenetic protein-7, HEK b NGF cyt-579 Hystemcell.cn Recombinant Human beta Nerve Growth Factor b NGF CHO cyt-246 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, CHO b NGF HEK cyt-079 Hystemcell.cn Recombinant Human beta Nerve Growth Factor, HEK mb NGF cyt-581 Hystemcell.cn Recombinant Mouse beta Nerve Growth Factor mb NGF cyt-440 Mouse beta Nerve Growth Factor ProNGF cyt-426 Hystemcell.cn Recombinant Human Pro-Nerve Growth Factor BNP cyt-327 Hystemcell.cn Recombinant Human B-type Natriuretic Protein BNP His cyt-605 Hystemcell.cn Recombinant Human B-type Natriuretic Protein His Tag BNP cyt-369 Human B-type Natriuretic Protein BST2 cyt-059 Hystemcell.cn Recombinant Human Bone Marrow Stromal Cell Antigen 2 BTC cyt-330 Hystemcell.cn Recombinant Human Betacellulin BTC His cyt-077 Hystemcell.cn Recombinant Human Betacellulin, His Tag mBTC cyt-131 Hystemcell.cn Recombinant Mouse Betacellulin bBTC cyt-406 Hystemcell.cn Recombinant Bovine Betacellulin CDNF cyt-167 Hystemcell.cn Recombinant Human Cerebral Dopamine Neurotrophic Factor mCDNF cyt-729 Hystemcell.cn Recombinant Mouse Cerebral Dopamine Neurotrophic Factor rCDNF cyt-730 Hystemcell.cn Recombinant Rat Cerebral Dopamine Neurotrophic Factor CLCF1 cyt-071 Hystemcell.cn Recombinant Human Cardiotrophin-Like Cytokine Factor 1 CNTF cyt-272 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor CNTF His cyt-573 Hystemcell.cn Recombinant Human Ciliary Neurotrophic Factor, His Tag mCNTF cyt-139 Hystemcell.cn Recombinant Mouse Ciliary Neurotrophic Factor rCNTF cyt-654 Hystemcell.cn Recombinant Rat Ciliary Neurotrophic Factor CT 1 cyt-436 Hystemcell.cn Recombinant Human Cardiotrophin-1 mCT 1 cyt-151 Hystemcell.cn Recombinant Mouse Cardiotrophin-1 rCT 1 cyt-199 Hystemcell.cn Recombinant Rat Cardiotrophin-1 CTGF cyt-541 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor CTGF His cyt-438 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, His Tag CTGF (182-250 a.a.) cyt-526 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor 182-250 a.a. CTGF HEK cyt-687 Hystemcell.cn Recombinant Human Connective Tissue Growth Factor, HEK CTLA 4 cyt-366 Hystemcell.cn Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4 CYR61 cyt-164 Hystemcell.cn Recombinant Human Cysteine-Rich Angiogenic Inducer 61 EBI3 cyt-367 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3 EBI3 His cyt-668 Hystemcell.cn Recombinant Human Epstein Barr Virus Induced 3, His Tag mEBI3 cyt-621 Hystemcell.cn Recombinant Mouse Epstein Barr Virus Induced 3 EG VEGF cyt-338 Hystemcell.cn Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor EGF cyt-217 Hystemcell.cn Recombinant Human Epidermal Growth Factor EGF Pichia cyt-332 Hystemcell.cn Recombinant Human Epidermal Growth Factor, Pichia EGF (Leu 21) cyt-466 Hystemcell.cn Recombinant Human Epidermal Growth Factor 21-Leu mEGF cyt-326 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor mEGF cyt-554 Mouse Epidermal Growth Factor mEGF, His cyt-138 Hystemcell.cn Recombinant Mouse Epidermal Growth Factor, His rEGF cyt-556 Rat Epidermal Growth Factor rEGF cyt-669 Hystemcell.cn Recombinant Rat Epidermal Growth Factor EMAP II cyt-607 Hystemcell.cn Recombinant Human Endothelial-Monocyte Activating Polypeptide II AIMP1 cyt-021 Hystemcell.cn Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 Endoglin Sf9 cyt-389 Hystemcell.cn Recombinant Human Endoglin, Sf9 Endoglin cyt-525 Hystemcell.cn Recombinant Human Endoglin mEndoglin cyt-424 Hystemcell.cn Recombinant Mouse Endoglin EPGN cyt-601 Hystemcell.cn Recombinant Human Epigen EREG cyt-609 Hystemcell.cn Recombinant Human Epiregulin EPO a cyt-201 Hystemcell.cn Recombinant Human Erythropoietin-alpha EPO a Fc cyt-325 Hystemcell.cn Recombinant Human Erythropoietin-alpha Fc/Chimera EPO a HEK cyt-083 Hystemcell.cn Recombinant Human Erythropoietin-alpha, HEK FAS cyt-125 Hystemcell.cn Recombinant Human sFas Receptor FASLG cyt-031 Hystemcell.cn Recombinant Human FAS Ligand FASLG HEK cyt-051 Hystemcell.cn Recombinant Human FAS Ligand, HEK FGF 1 cyt-264 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic FGF 1 Sf9 cyt-364 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-acidic, Sf9 mFGF 1 cyt-528 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic mFGF 1 His cyt-072 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag rFGF 1 cyt-075 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-acidic baFGF cyt-613 Bovine Fibroblast Growth Factor-acidic FGF 2 cyt-218 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic FGF 2 Sf9 cyt-365 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Sf9 FGF 2 (147 a.a.) cyt-557 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic (147 a.a) FGF 2 293 Cells cyt-085 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, 293 Cells FGF2 Plant cyt-123 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-basic, Plant bFGF 2 cyt-288 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-basic bFGF 2 cyt-560 Bovine Fibroblast Growth Factor-basic mFGF 2 cyt-386 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-basic rFGF 2 cyt-608 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-basic FGF 4 cyt-312 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4 FGF 4 HEK cyt-084 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-4, HEK FGF 8 cyt-714 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8 mFGF 8 cyt-070 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-8 FGF 8 HEK cyt-087 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-8, HEK FGF 9 cyt-415 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-9 mFGF 9 cyt-349 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-9 rFGF 9 cyt-558 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-9 FGF12 cyt-620 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 12 FGF13 cyt-121 Hystemcell.cn Recombinant Human Fibroblast Growth Factor 13 mFGF-15 cyt-027 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-15 FGF-18 cyt-120 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-18 mFGF-18 cyt-064 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-18 rFGF-18 cyt-176 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-18 FGF 19 cyt-700 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19 FGF 19 His cyt-279 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-19 His Tag FGF 21 cyt-474 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21 FGF 21 His cyt-281 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-21, His Tag mFGF 21 cyt-339 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21 mFGF 21 His cyt-516 Hystemcell.cn Recombinant Mouse Fibroblast Growth Factor-21, His Tag rFGF 21 cyt-130 Hystemcell.cn Recombinant Rat Fibroblast Growth Factor-21 bFGF 21 cyt-657 Hystemcell.cn Recombinant Bovine Fibroblast Growth Factor-21 FGF 22 cyt-428 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-22 FGF 23 cyt-020 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 FGF 23 His cyt-374 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 His Tag FGF 23 C-term cyt-028 Hystemcell.cn Recombinant Human Fibroblast Growth Factor-23 C-Terminal Flt3 Ligand cyt-331 Hystemcell.cn Recombinant Human Flt3-Ligand Flt3 Ligand HEK cyt-706 Hystemcell.cn Recombinant Human Flt3-Ligand, HEK Flt3 Ligand Sf9 cyt-409 Hystemcell.cn Recombinant Human Flt3-Ligand, Sf9 mFlt3 Ligand cyt-340 Hystemcell.cn Recombinant Mouse Flt3-Ligand rmFlt3 Ligand cyt-157 Hystemcell.cn Recombinant Rhesus Macaque Flt3-Ligand FST cyt-232 Hystemcell.cn Recombinant Human Follistatin FST His cyt-029 Hystemcell.cn Recombinant Human Follistatin His Tag mFST cyt-124 Hystemcell.cn Recombinant Mouse Follistatin HB-EGF cyt-119 Hystemcell.cn Recombinant Human Proheparin-Binding EGF-like Growth Factor mHB-EGF cyt-068 Hystemcell.cn Recombinant Mouse Proheparin-Binding EGF-like Growth Factor rHB-EGF cyt-170 Hystemcell.cn Recombinant Rat Proheparin-Binding EGF-like Growth Factor LGALS1 cyt-544 Hystemcell.cn Recombinant Human Galectin-1 mLGALS1 cyt-186 Hystemcell.cn Recombinant Mouse Galectin-1 LGALS2 cyt-725 Hystemcell.cn Recombinant Human Galectin-2 mLGALS2 cyt-019 Hystemcell.cn Recombinant Mouse Galectin-2 LGALS3 cyt-606 Hystemcell.cn Recombinant Human Galectin-3 LGALS3 His cyt-693 Hystemcell.cn Recombinant Human Galectin-3 His Tag mLGALS3 cyt-188 Hystemcell.cn Recombinant Mouse Galectin-3 LGALS4 cyt-686 Hystemcell.cn Recombinant Human Galectin-4 mLGALS4 cyt-187 Hystemcell.cn Recombinant Mouse Galectin-4 LGALS7 cyt-016 Hystemcell.cn Recombinant Human Galectin-7 LGALS7 His cyt-617 Hystemcell.cn Recombinant Human Galectin-7 His Tag mLGALS7 cyt-184 Hystemcell.cn Recombinant Mouse Galectin-7 LGALS8 cyt-017 Hystemcell.cn Recombinant Human Galectin-8 LGALS8 His cyt-727 Hystemcell.cn Recombinant Human Galectin-8, His Tag mLGALS8 cyt-185 Hystemcell.cn Recombinant Mouse Galectin-8 LGALS9 cyt-708 Hystemcell.cn Recombinant Human Galectin-9 mLGALS9 cyt-550 Hystemcell.cn Recombinant Mouse Galectin-9 LGALS13 cyt-004 Hystemcell.cn Recombinant Human Galectin-13 LGALS14 cyt-003 Hystemcell.cn Recombinant Human Galectin-14 LGALSL cyt-073 Hystemcell.cn Recombinant Human Galectin-Related Protein GDNF cyt-305 Hystemcell.cn Recombinant Human Glial-Derived Neurotrophic Factor GDF3 cyt-694 Hystemcell.cn Recombinant Human Growth and Differentiation factor 3 GDF5 cyt-442 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5 GDF5 His cyt-653 Hystemcell.cn Recombinant Human Growth and Differentiation factor 5 His Tag GDF10 cyt-659 Hystemcell.cn Recombinant Human Growth and Differentiation factor 10 GDF15 His cyt-691 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15, His Tag GDF15 D cyt-314 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15 D-Vairant GDF15 cyt-335 Hystemcell.cn Recombinant Human Growth and Differentiation factor 15 G CSF cyt-220 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor G CSF His cyt-476 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag G CSF CHO cyt-329 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, CHO G CSF PEG cyt-018 Hystemcell.cn Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor G CSF HEK cyt-088 Hystemcell.cn Recombinant Human Granulocyte-Colony Stimulating Factor, HEK mG CSF cyt-410 Hystemcell.cn Recombinant Mouse Granulocyte-Colony Stimulating Factor GH cyt-202 Hystemcell.cn Recombinant Human Growth Hormone pGH 22kDa cyt-235 Hystemcell.cn Recombinant Human Placental Corr Growth Hormone GH 20kDa cyt-259 Hystemcell.cn Recombinant Human Pituitary Growth Hormone 20kDa pGH 20kDa cyt-337 Hystemcell.cn Recombinant Human Placental Growth Hormone 20kDa GH Plant cyt-053 Hystemcell.cn Recombinant Human Growth Hormone, Plant GH HEK cyt-091 Hystemcell.cn Recombinant Human Growth Hormone, HEK GHBP cyt-238 Hystemcell.cn Recombinant Human Growth Hormone Binding Protein oGHBP cyt-470 Hystemcell.cn Recombinant Ovine Growth Hormone Binding Protein bGHBP cyt-471 Hystemcell.cn Recombinant Bovine Growth Hormone Binding Protein raGHBP cyt-593 Hystemcell.cn Recombinant Rabbit Growth Hormone Binding Protein chGH cyt-430 Hystemcell.cn Recombinant Chicken Growth Hormone oGH cyt-237 Hystemcell.cn Recombinant Ovine Growth Hormone oGH Placental cyt-594 Hystemcell.cn Recombinant Placental Ovine Growth Hormone bGH cyt-636 Hystemcell.cn Recombinant Bovine Growth Hormone mGH cyt-540 Hystemcell.cn Recombinant Mouse Growth Hormone rGH cyt-296 Hystemcell.cn Recombinant Rat Growth Hormone cGH cyt-297 Hystemcell.cn Recombinant Carp Growth Hormone dGH cyt-498 Hystemcell.cn Recombinant Denis Growth Hormone maiGH cyt-499 Hystemcell.cn Recombinant Mai Mai Growth Hormone sGH cyt-529 Hystemcell.cn Recombinant Gilthead Seabream Growth Hormone raGH cyt-514 Hystemcell.cn Recombinant Rabbit Growth Hormone pGH cyt-519 Hystemcell.cn Recombinant Porcine Growth Hormone chGH Antagonist cyt-538 Hystemcell.cn Recombinant Chicken Growth Hormone Anatagonist oGH Antagonist cyt-215 Hystemcell.cn Recombinant Ovine Growth Hormone Anatagonist zGH cyt-710 Hystemcell.cn Recombinant Zebrafish Growth Hormone zGH Mutant cyt-709 Hystemcell.cn Recombinant Zebrafish Growth Hormone Mutant GM CSF cyt-221 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor GM CSF Pichia cyt-324 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia GM CSF Sf9 cyt-416 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9 GM CSF HEK cyt-089 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK GM CSF His cyt-477 Hystemcell.cn Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag PIXY321 cyt-360 Hystemcell.cn Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321) mGM CSF cyt-222 Hystemcell.cn Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor rGM CSF cyt-395 Hystemcell.cn Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor pGM CSF cyt-401 Hystemcell.cn Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor rmGM CSF cyt-720 Hystemcell.cn Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor k9GM CSF cyt-724 Hystemcell.cn Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor GMF b cyt-565 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta GMF b His cyt-726 Hystemcell.cn Recombinant Human Glia Maturation Factor Beta His Tag mGMF b cyt-006 Hystemcell.cn Recombinant Mouse Glia Maturation Factor Beta rGMF b cyt-049 Hystemcell.cn Recombinant Rat Glia Maturation Factor Beta GMFG cyt-632 Hystemcell.cn Recombinant Human Glia Maturation Factor Gamma HDGF cyt-681 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor HDGF2 cyt-132 Hystemcell.cn Recombinant Human Hepatoma-Derived Growth Factor-2 HGF CHO cyt-251 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, CHO HGF Sf9 cyt-244 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, Sf9 HGF HEK cyt-090 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor, HEK HGF-A cyt-664 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor A Chain HGF-B cyt-665 Hystemcell.cn Recombinant Human Hepatocyte Growth Factor B Chain pHGF cyt-522 Porcine Hepatocyte Promoting Growth Factor IFI30 cyt-183 Hystemcell.cn Recombinant Human Interferon Gamma-Inducible protein 30 IFN a 1 cyt-291 Hystemcell.cn Recombinant Human Interferon-alpha 1 IFN a 1a cyt-520 Hystemcell.cn Recombinant Human Interferon-alpha 1a IFN a 1b cyt-283 Hystemcell.cn Recombinant Human Interferon-alpha 1b IFN a 2a cyt-204 Hystemcell.cn Recombinant Human Interferon-alpha 2a IFN a 2a Plant cyt-543 Hystemcell.cn Recombinant Human Interferon-alpha 2a, Tobacco IFN a 2b cyt-205 Hystemcell.cn Recombinant Human Interferon-alpha 2b IFN a 2b Yeast cyt-460 Hystemcell.cn Recombinant Human Interferon-alpha 2b, Saccharomyces IFN a 2b 20kd-PEG cyt-034 Hystemcell.cn Recombinant Human Interferon-alpha 2b 20kd-Pegylated IFN a 2b HEK cyt-092 Hystemcell.cn Recombinant Human Interferon-alpha 2b, HEK IFN a 2a HEK cyt-093 Hystemcell.cn Recombinant Human Interferon-alpha 2a, HEK IFNA7 cyt-196 Hystemcell.cn Recombinant Human Interferon-alpha 7 IFNA14 cyt-135 Hystemcell.cn Recombinant Human Interferon-alpha 14 IFN b 1a cyt-236 Hystemcell.cn Recombinant Human Interferon-beta 1a IFN b 1b cyt-234 Hystemcell.cn Recombinant Human Interferon-beta 1b mIFN b His cyt-651 Hystemcell.cn Recombinant Mouse Interferon-beta His Tag IFN g cyt-206 Hystemcell.cn Recombinant Human Interferon-gamma IFN g His cyt-478 Hystemcell.cn Recombinant Human Interferon-gamma His Tag mIFN g cyt-358 Hystemcell.cn Recombinant Mouse Interferon-gamma rIFN g cyt-359 Hystemcell.cn Recombinant Rat Interferon-gamma pIFN g cyt-402 Hystemcell.cn Recombinant Porcine Interferon-gamma qIFN g cyt-739 Hystemcell.cn Recombinant Equine Interferon-gamma IFNW1 cyt-040 Hystemcell.cn Recombinant Human Interferon-Omega 1 oIFN tau cyt-377 Hystemcell.cn Recombinant Ovine Interferon-Tau IRF 1 cyt-449 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-1 IRF 2 cyt-534 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-2 IRF 3 cyt-292 Hystemcell.cn Recombinant Human Interferon Regulatory Factor-3 IGF1 cyt-216 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 IGF1 GST cyt-690 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1, GST-Tag IGF1 Des1-3 cyt-518 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 Des (1-3) Long R3 IGF1 cyt-022 Hystemcell.cn Recombinant Human LR3 Insulin Like Growth Factor-1 IGF1 N15 cyt-128 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-1 N15 Labeled mIGF1 cyt-229 Hystemcell.cn Recombinant Mouse Insulin Like Growth Factor-1 rIGF1 cyt-289 Hystemcell.cn Recombinant Rat Insulin Like Growth Factor-1 sIGF1 cyt-295 Hystemcell.cn Recombinant Gilthead Seabream Insulin Like Growth Factor-1 IGF2 cyt-265 Hystemcell.cn Recombinant Human Insulin Like Growth Factor-2 pro-IGF2 cyt-110 Hystemcell.cn Recombinant Human Pro-Insulin Like Growth Factor-2 IGFBP 1 cyt-299 Human Insulin Like Growth Factor Binding Protein-1 IGFBP 3 cyt-300 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-3 IGFBP 4 cyt-030 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-4 IGFBP 5 cyt-464 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-5 IGFBP 6 cyt-258 Hystemcell.cn Recombinant Human Insulin Like Growth Factor Binding Protein-6 IHH cyt-195 Hystemcell.cn Recombinant Human Indian Hedgehog IL 1 alpha cyt-253 Hystemcell.cn Recombinant Human Interleukin-1 alpha IL 1 alpha His cyt-479 Hystemcell.cn Recombinant Human Interleukin-1 alpha, His Tag mIL 1 alpha cyt-523 Hystemcell.cn Recombinant Mouse Interleukin-1 alpha rIL 1 alpha cyt-381 Hystemcell.cn Recombinant Rat Interleukin-1 alpha pIL 1 alpha cyt-396 Hystemcell.cn Recombinant Porcine Interleukin-1 alpha IL 1 beta cyt-208 Hystemcell.cn Recombinant Human Interleukin-1 beta IL 1 beta His cyt-480 Hystemcell.cn Recombinant Human Interleukin-1 beta, His Tag IL 1 beta HEK cyt-094 Hystemcell.cn Recombinant Human Interleukin-1 beta, HEK mIL 1 beta cyt-273 Hystemcell.cn Recombinant Mouse Interleukin-1 beta mIL 1 beta His cyt-578 Hystemcell.cn Recombinant Mouse Interleukin-1 beta, His Tag rIL 1 beta cyt-394 Hystemcell.cn Recombinant Rat Interleukin-1 beta pIL 1 beta cyt-400 Hystemcell.cn Recombinant Porcine Interleukin-1 beta rmIL 1 beta cyt-718 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-1 beta IL 1RA cyt-203 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist IL 1RA His cyt-481 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Antagonist, His Tag IL1RL1 cyt-671 Hystemcell.cn Recombinant Human Interleukin-1 Receptor Like-1 mIL 1RA cyt-658 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist mIL 1RA His cyt-136 Hystemcell.cn Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag rIL 1RA cyt-152 Hystemcell.cn Recombinant Rat Interleukin-1 Receptor Antagonist hIL 1RA cyt-010 Hystemcell.cn Recombinant Horse Interleukin-1 Receptor Antagonist IL 2 cyt-209 Hystemcell.cn Recombinant Human Interleukin-2 IL 2 His cyt-666 Hystemcell.cn Recombinant Human Interleukin-2 His Tag IL 2 HEK cyt-095 Hystemcell.cn Recombinant Human Interleukin 2, HEK mIL 2 cyt-370 Hystemcell.cn Recombinant Mouse Interleukin-2 mIL 2 His cyt-624 Hystemcell.cn Recombinant Mouse Interleukin-2, His Tag rIL 2 cyt-382 Hystemcell.cn Recombinant Rat Interleukin-2 pIL 2 cyt-397 Hystemcell.cn Recombinant Porcine Interleukin-2 qIL2 cyt-738 Hystemcell.cn Recombinant Equine Interleukin-2 sIL 2R cyt-285 Hystemcell.cn Recombinant Human Soluble Iinterleukin-2 Receptor alpha IL 3 cyt-210 Hystemcell.cn Recombinant Human Interleukin-3 IL 3 His cyt-482 Hystemcell.cn Recombinant Human Interleukin-3, His Tag IL 3 HEK cyt-096 Hystemcell.cn Recombinant Human Interleukin 3, HEK mIL 3 cyt-371 Hystemcell.cn Recombinant Mouse Interleukin-3 rIL 3 cyt-383 Hystemcell.cn Recombinant Rat Interleukin-3 IL 3 Sf9 cyt-417 Hystemcell.cn Recombinant Human Interleukin-3, Sf9 k9 IL 3 cyt-722 Hystemcell.cn Recombinant Canine Interleukin-3 rmIL3 cyt-156 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-3 IL 4 cyt-211 Hystemcell.cn Recombinant Human Interleukin-4 IL 4 CHO cyt-271 Hystemcell.cn Recombinant Human Interleukin-4 CHO IL 4 His cyt-483 Hystemcell.cn Recombinant Human Interleukin-4, His Tag IL 4 HEK cyt-097 Hystemcell.cn Recombinant Human Interleukin 4, HEK mIL 4 cyt-282 Hystemcell.cn Recombinant Mouse Interleukin-4 rIL 4 cyt-385 Hystemcell.cn Recombinant Rat Interleukin-4 pIL 4 cyt-398 Hystemcell.cn Recombinant Porcine Interleukin-4 rmIL4 cyt-172 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-4 IL 5 cyt-212 Hystemcell.cn Recombinant Human Interleukin-5 mIL 5 cyt-689 Hystemcell.cn Recombinant Mouse Interleukin-5 rIL 5 cyt-387 Hystemcell.cn Recombinant Rat Interleukin-5 IL 6 cyt-213 Hystemcell.cn Recombinant Human Interleukin-6 IL 6 CHO cyt-274 Hystemcell.cn Recombinant Human Interleukin-6, CHO IL 6 His cyt-484 Hystemcell.cn Recombinant Human Interleukin-6, His Tag IL 6 HEK cyt-098 Hystemcell.cn Recombinant Human Interleukin 6, HEK mIL 6 cyt-350 Hystemcell.cn Recombinant Mouse Interleukin-6 rIL 6 cyt-388 Hystemcell.cn Recombinant Rat Interleukin-6 pIL 6 cyt-399 Hystemcell.cn Recombinant Porcine Interleukin-6 rmIL 6 cyt-174 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-6 sIL 6R cyt-286 Hystemcell.cn Recombinant Human Soluble IL-6 Receptor alpha IL 7 cyt-254 Hystemcell.cn Recombinant Human Interleukin-7 IL 7 Yeast cyt-298 Hystemcell.cn Recombinant Human Interleukin-7, Saccharomyces IL 7 His cyt-485 Hystemcell.cn Recombinant Human Interleukin-7, His Tag IL 7, HEK cyt-197 Hystemcell.cn Recombinant Human Interleukin-7, HEK mIL 7 cyt-372 Hystemcell.cn Recombinant Mouse Interleukin-7 rIL 7 cyt-163 Hystemcell.cn Recombinant Rat Interleukin-7 IL 9 cyt-348 Hystemcell.cn Recombinant Human Interleukin-9 IL 9 HEK cyt-099 Hystemcell.cn Recombinant Human Interleukin 9, HEK mIL 9 cyt-373 Hystemcell.cn Recombinant Mouse Interleukin-9 rIL 9 cyt-748 Hystemcell.cn Recombinant Rat Interleukin-9 IL 10 cyt-500 Hystemcell.cn Recombinant Human Interleukin-10 IL 10 His cyt-486 Hystemcell.cn Recombinant Human Interleukin-10, His Tag IL 10 HEK cyt-100 Hystemcell.cn Recombinant Human Interleukin 10, HEK mIL 10 cyt-497 Hystemcell.cn Recombinant Mouse Interleukin-10 rIL 10 cyt-465 Hystemcell.cn Recombinant Rat Interleukin-10 pIL 10 cyt-404 Hystemcell.cn Recombinant Porcine Interleukin-10 IL 11 cyt-214 Hystemcell.cn Recombinant Human Interleukin-11 IL 11 Pichia cyt-013 Hystemcell.cn Recombinant Human Interleukin-11, Pichia mIL 11 cyt-646 Hystemcell.cn Recombinant Mouse Interleukin-11 IL 12 cyt-101 Hystemcell.cn Recombinant Human Interleukin 12 IL 12 p35 His cyt-487 Hystemcell.cn Recombinant Human Interleukin-12 p35, His Tag IL 12 p40 Baculovirus cyt-134 Hystemcell.cn Recombinant Human Interleukin-12 p40, Baculovirus IL 12 p40 His cyt-488 Hystemcell.cn Recombinant Human Interleukin-12 p40, His Tag IL 12 p40 Plant cyt-056 Hystemcell.cn Recombinant Human Interleukin-12 p40, Plant mIL 12 cyt-144 Hystemcell.cn Recombinant Mouse Interleukin-12 rIL 12 cyt-390 Hystemcell.cn Recombinant Rat Interleukin-12 IL 13 cyt-446 Hystemcell.cn Recombinant Human Interleukin-13 IL 13 Variant cyt-682 Hystemcell.cn Recombinant Human Interleukin-13 Variant IL 13 His cyt-489 Hystemcell.cn Recombinant Human Interleukin-13, His Tag mIL 13 cyt-375 Hystemcell.cn Recombinant Mouse Interleukin-13 rIL 13 cyt-391 Hystemcell.cn Recombinant Rat Interleukin-13 rIL 13 109 a.a. cyt-182 Hystemcell.cn Recombinant Rat Interleukin-13 109 a.a. rmIL 13 cyt-175 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-13 IL 15 cyt-230 Hystemcell.cn Recombinant Human Interleukin-15 IL 15 His cyt-490 Hystemcell.cn Recombinant Human Interleukin-15, His Tag mIL 15 cyt-344 Hystemcell.cn Recombinant Mouse Interleukin-15 mIL 15 His cyt-647 Hystemcell.cn Recombinant Mouse Interleukin-15, His Tag rIL 15 cyt-345 Hystemcell.cn Recombinant Rat Interleukin-15 pIL 15 cyt-403 Hystemcell.cn Recombinant Porcine Interleukin-15 IL 16, (130 a.a.) cyt-536 Hystemcell.cn Recombinant Human Interleukin-16, (130 a.a.) IL 16, (121 a.a.) cyt-142 Hystemcell.cn Recombinant Human Interleukin-16, (121 a.a.) IL 16 His cyt-562 Hystemcell.cn Recombinant Human Interleukin-16, His Tag mIL 16 cyt-559 Hystemcell.cn Recombinant Mouse Interleukin-16 maIL 16 cyt-153 Hystemcell.cn Recombinant Rhesus Macaque Interleukin-16 IL 17A cyt-250 Hystemcell.cn Recombinant Human Interleukin-17A IL 17A His cyt-662 Hystemcell.cn Recombinant Human Interleukin-17A His Tag IL 17A HEK cyt-102 Hystemcell.cn Recombinant Human Interleukin 17A, HEK IL 17E cyt-583 Hystemcell.cn Recombinant Human Interleukin-17E IL 17F cyt-587 Hystemcell.cn Recombinant Human Interleukin-17F IL 17F HEK cyt-103 Hystemcell.cn Recombinant Human Interleukin 17F, HEK IL 17 A/F cyt-623 Hystemcell.cn Recombinant Human Interleukin-17 A/F Heterodimer mIL 17 cyt-378 Hystemcell.cn Recombinant Mouse Interleukin-17A mIL 17E cyt-641 Hystemcell.cn Recombinant Mouse Interleukin-17E mIL 17F cyt-642 Hystemcell.cn Recombinant Mouse Interleukin-17F mIL 17 A/F cyt-640 Hystemcell.cn Recombinant Mouse Interleukin-17 A/F Heterodimer rIL 17 A/F cyt-677 Hystemcell.cn Recombinant Rat Interleukin-17 A/F Heterodimer rIL 17 cyt-542 Hystemcell.cn Recombinant Rat Interleukin-17A rIL 17E cyt-576 Hystemcell.cn Recombinant Rat Interleukin-17E rIL 17F cyt-643 Hystemcell.cn Recombinant Rat Interleukin-17F IL 18 cyt-269 Hystemcell.cn Recombinant Human Interleukin-18 IL 18 His cyt-663 Hystemcell.cn Recombinant Human Interleukin-18 His Tag IL18BP cyt-728 Hystemcell.cn Recombinant Human Interleukin-18 Binding Protein mIL 18 cyt-634 Hystemcell.cn Recombinant Mouse Interleukin-18 rIL 18 cyt-376 Hystemcell.cn Recombinant Rat Interleukin-18 IL 19 cyt-363 Hystemcell.cn Recombinant Human Interleukin-19 mIL 19 cyt-411 Hystemcell.cn Recombinant Mouse Interleukin-19 IL 20 cyt-347 Hystemcell.cn Recombinant Human Interleukin-20 mIL 20 cyt-379 Hystemcell.cn Recombinant Mouse Interleukin-20 IL 21 cyt-408 Hystemcell.cn Recombinant Human Interleukin-21 mIL 21 cyt-684 Hystemcell.cn Recombinant Mouse Interleukin-21 rIL 21 cyt-033 Hystemcell.cn Recombinant Rat Interleukin-21 IL 22 cyt-328 Hystemcell.cn Recombinant Human Interleukin-22 mIL 22 cyt-539 Hystemcell.cn Recombinant Mouse Interleukin-22 rIL 22 cyt-173 Hystemcell.cn Recombinant Rat Interleuikin-22 mIL 22 PEG cyt-701 Hystemcell.cn Recombinant Mouse Interleukin-22, Pegylated mIL 22A cyt-148 Hystemcell.cn Recombinant Mouse Interleukin-22 Antagonist (E117A) IL 23 cyt-050 Hystemcell.cn Recombinant Human Interleukin-23 IL 23 His cyt-067 Hystemcell.cn Recombinant Human Interleukin-23, His Tag IL 24 cyt-515 Hystemcell.cn Recombinant Human Interleukin-24 IL 27 cyt-048 Hystemcell.cn Recombinant Human Interleukin-27 p28 mIL 27 cyt-570 Hystemcell.cn Recombinant Mouse Interleukin-27 IL 28A cyt-602 Hystemcell.cn Recombinant Human Interleukin-28A IL 28A HEK cyt-104 Hystemcell.cn Recombinant Human Interleukin-28A, HEK mIL 28A cyt-741 Hystemcell.cn Recombinant Mouse Interleukin-28A IL 28B cyt-105 Hystemcell.cn Recombinant Human Interleukin-28B mIL 28B cyt-732 Hystemcell.cn Recombinant Mouse Interleukin-28B IL 29 cyt-603 Hystemcell.cn Recombinant Human Interleukin-29 IL 29 HEK cyt-117 Hystemcell.cn Recombinant Human Interleukin-29, HEK IL 31 cyt-625 Hystemcell.cn Recombinant Human Interleukin-31 mIL 31 cyt-604 Hystemcell.cn Recombinant Mouse Interleukin-31 IL 32A cyt-584 Hystemcell.cn Recombinant Human IL-32 alpha IL 32A His Tag cyt-648 Hystemcell.cn Recombinant Human IL-32 alpha His Tag IL 33 cyt-425 Hystemcell.cn Recombinant Human Interleukin-33 IL 33 His cyt-667 Hystemcell.cn Recombinant Human Interleukin-33 His Tag mIL 33 cyt-655 Hystemcell.cn Recombinant Mouse Interleukin-33 rIL 33 cyt-150 Hystemcell.cn Recombinant Rat Interleukin-33 IL34 cyt-042 Hystemcell.cn Recombinant Human Interleukin-34 IL36RN cyt-009 Hystemcell.cn Recombinant Human Interleukin-36 Receptor Antagonist mIL36RN cyt-154 Hystemcell.cn Recombinant Mouse Interleukin-36 Receptor Antagonist IL36A cyt-158 Hystemcell.cn Recombinant Human Interleukin-36 Alpha IL36A 158 a.a. cyt-179 Hystemcell.cn Recombinant Human Interleukin-36 Alpha 158 a.a. mIL36A cyt-162 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha mIL36A 153 a.a. cyt-181 Hystemcell.cn Recombinant Mouse Interleukin-36 Alpha 153 a.a. IL36B cyt-159 Hystemcell.cn Recombinant Human Interleukin-36 Beta IL36B 153 a.a. cyt-180 Hystemcell.cn Recombinant Human Interleukin-36 Beta 153 a.a mIL36B cyt-165 Hystemcell.cn Recombinant Mouse Interleukin-36 Beta IL36G cyt-160 Hystemcell.cn Recombinant Human Interleukin-36 Gamma IL36G 152 a.a. cyt-161 Hystemcell.cn Recombinant Human Interleukin-36 Gamma 152 a.a. mIL36G cyt-745 Hystemcell.cn Recombinant Mouse Interleukin-36 Gamma IL37 cyt-011 Hystemcell.cn Recombinant Human Interleukin 37 IL1F10 cyt-012 Hystemcell.cn Recombinant Human Interleukin 1 Family, Member 10 Insulin cyt-270 Hystemcell.cn Recombinant Human Insulin Insulin Yeast cyt-614 Hystemcell.cn Recombinant Human Insulin Yeast pInsulin cyt-468 Porcine Insulin KGF cyt-219 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor mKGF cyt-721 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor KGF HEK cyt-086 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor, HEK KGF 2 cyt-303 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2 KGF 2 His cyt-129 Hystemcell.cn Recombinant Human Keratinocyte Growth Factor-2, His Tag mKGF 2 cyt-126 Hystemcell.cn Recombinant Mouse Keratinocyte Growth Factor-2 rKGF cyt-127 Hystemcell.cn Recombinant Rat Keratinocyte Growth Factor-2 Leptin cyt-228 Hystemcell.cn Recombinant Human Leptin Leptin cyt-683 Human Leptin Leptin His cyt-287 Hystemcell.cn Recombinant Human Leptin, His Tag mLeptin cyt-351 Hystemcell.cn Recombinant Mouse Leptin mLeptin PEG cyt-591 Hystemcell.cn Recombinant Pegylated Mouse Leptin rLeptin cyt-227 Hystemcell.cn Recombinant Rat Leptin rLeptin PEG cyt-592 Hystemcell.cn Recombinant Pegylated Rat Leptin oLeptin cyt-239 Hystemcell.cn Recombinant Ovine Leptin oLeptin, MTS cyt-531 Hystemcell.cn Recombinant Ovine Leptin, MTS tag bLeptin cyt-502 Hystemcell.cn Recombinant Bovine Leptin pLeptin cyt-503 Hystemcell.cn Recombinant Porcine Leptin pfLeptin cyt-530 Hystemcell.cn Recombinant Pufferfish Leptin sLeptin cyt-704 Hystemcell.cn Recombinant Salamander Leptin hLeptin cyt-504 Hystemcell.cn Recombinant Horse Leptin chLeptin cyt-505 Hystemcell.cn Recombinant Chicken Leptin dLeptin cyt-506 Hystemcell.cn Recombinant Dog Leptin raLeptin cyt-507 Hystemcell.cn Recombinant Rabbit Leptin Leptin tA cyt-352 Hystemcell.cn Recombinant Human Leptin Triple Antagonist Leptin tA PEG cyt-702 Hystemcell.cn Recombinant Human Leptin Triple Antagonist, Pegylated Leptin qA cyt-353 Hystemcell.cn Recombinant Human Leptin Quadruple Antagonist mLeptin tA cyt-354 Hystemcell.cn Recombinant Mouse Leptin Triple Antagonist mLeptin tA PEG cyt-566 Hystemcell.cn Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated rLeptin tA cyt-355 Hystemcell.cn Recombinant Rat Leptin Triple Antagonist rLeptin tA PEG cyt-567 Hystemcell.cn Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated oLeptin tA cyt-356 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist oLeptin tA PEG cyt-703 Hystemcell.cn Recombinant Ovine Leptin Triple Antagonist, Pegylated oLeptin qA cyt-357 Hystemcell.cn Recombinant Ovine Leptin Quadruple Antagonist Leptin Receptor cyt-508 Hystemcell.cn Recombinant Human Leptin Binding Domain chLeptin Receptor cyt-509 Hystemcell.cn Recombinant Chicken Leptin Binding Domain LFA 3 cyt-423 Hystemcell.cn Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein LIF cyt-644 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor mLIF cyt-645 Hystemcell.cn Recombinant Mouse Leukemia Inhibitory Factor LIF GST cyt-001 Hystemcell.cn Recombinant Human Leukemia Inhibitory Factor, GST tag rLIF cyt-731 Hystemcell.cn Recombinant Rat Leukemia Inhibitory Factor MANF, His cyt-133 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag MANF cyt-141 Hystemcell.cn Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor M CSF cyt-308 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor M CSF Baculovirus cyt-637 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus M CSF HEK cyt-106 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, HEK M CSF His cyt-695 Hystemcell.cn Recombinant Human Macrophage Colony Stimulating Factor, His Tag mM CSF cyt-439 Hystemcell.cn Recombinant Mouse Macrophage Colony Stimulating Factor rM CSF cyt-046 Hystemcell.cn Recombinant Rat Macrophage Colony Stimulating Factor MIF cyt-575 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor MIF (Active) cyt-596 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor MIF His N cyt-431 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus MIF His C cyt-521 Hystemcell.cn Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus mMIF cyt-744 Hystemcell.cn Recombinant Mouse Macrophage Migration Inhibitor Factor rMIF cyt-193 Hystemcell.cn Recombinant Rat Macrophage Migration Inhibitor Factor MIA cyt-310 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein MIA2 cyt-638 Hystemcell.cn Recombinant Human Melanoma Inhibitory Activity Protein 2 Midkine cyt-192 Hystemcell.cn Recombinant Human Midkine Midkine, His cyt-444 Hystemcell.cn Recombinant Human Midkine, His Tag mMidkine cyt-178 Hystemcell.cn Recombinant Mouse Midkine rMidkine cyt-747 Hystemcell.cn Recombinant Rat Midkine MTPN cyt-723 Hystemcell.cn Recombinant Human Myotrophin Myostatin cyt-418 Hystemcell.cn Recombinant Human Myostatin Myostatin His cyt-445 Hystemcell.cn Recombinant Human Myostatin, His-Tag Myostatin Propetide cyt-448 Hystemcell.cn Recombinant Human Myostatin Propeptide Myostatin Plant cyt-055 Hystemcell.cn Recombinant Human Myostatin, Plant NGB cyt-450 Hystemcell.cn Recombinant Human Neuroglobin NRG1 cyt-407 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b2 NRG1 B1 cyt-733 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin-b1 NRG1 A cyt-736 Hystemcell.cn Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain) NT 3 cyt-257 Hystemcell.cn Recombinant Human Neurotrophin-3 proNT3 cyt-015 Hystemcell.cn Recombinant Human Precursor Neurotrophin-3 mNT 3 cyt-688 Hystemcell.cn Recombinant Mouse Neurotrophin-3 NT 4 cyt-626 Hystemcell.cn Recombinant Human Neurotrophin-4 Noggin cyt-475 Hystemcell.cn Recombinant Human Noggin Noggin HEK cyt-107 Hystemcell.cn Recombinant Human Noggin, HEK mNoggin cyt-600 Hystemcell.cn Recombinant Mouse Noggin Omentin cyt-301 Hystemcell.cn Recombinant Human Omentin Omentin His cyt-551 Hystemcell.cn Recombinant Human Omentin His Tag Omentin 298 a.a. cyt-061 Hystemcell.cn Recombinant Human Omentin 298 a.a. OPG Fc cyt-266 Hystemcell.cn Recombinant Human Osteoprotegerin/Fc Chimera OPG cyt-177 Hystemcell.cn Recombinant Human Osteoprotegerin OPG His cyt-290 Hystemcell.cn Recombinant Human Osteoprotegerin, His Tag OPG Hi-5 cyt-633 Hystemcell.cn Recombinant Human Osteoprotegerin Hi-5 OSM cyt-231 Hystemcell.cn Recombinant Human Oncostatin-M OSM (209 a.a.) cyt-639 Hystemcell.cn Recombinant Human Oncostatin-M (209 a.a.) OSM (195 a.a.) cyt-735 Hystemcell.cn Recombinant Human Oncostatin-M (195 a.a.) OSM, His cyt-060 Hystemcell.cn Recombinant Human Oncostatin-M, His Tag OSM HEK cyt-108 Hystemcell.cn Recombinant Human Oncostatin-M, HEK mOSM cyt-168 Hystemcell.cn Recombinant Mouse Oncostatin-M rOSM cyt-169 Hystemcell.cn Recombinant Rat Oncostatin-M OSTF1 cyt-630 Hystemcell.cn Recombinant Human Osteoclast Stimulating Factor-1 OTOR cyt-582 Hystemcell.cn Recombinant Human Otoraplin PDGF AA cyt-341 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA PDGF AA Yeast cyt-568 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA, Yeast PDGF AA HEK cyt-109 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AA HEK PDGF A cyt-491 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-A mPDGF AA cyt-590 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-AA PDGF AB cyt-342 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-AB PDGF BB cyt-501 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-BB PDGF B cyt-492 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-B mPDGF BB cyt-412 Hystemcell.cn Recombinant Mouse Plaet Derived Growth Factor-BB rPDGF BB cyt-740 Hystemcell.cn Recombinant Rat Plaet Derived Growth Factor-BB PDGFD cyt-155 Hystemcell.cn Recombinant Human Plaet Derived Growth Factor-D PDGFRA cyt-065 Hystemcell.cn Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha PEDF cyt-580 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor PEDF His cyt-552 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, His Tag PEDF HEK cyt-553 Hystemcell.cn Recombinant Human Pigment Epithelium-Derived Factor, HEK Periostin cyt-452 Hystemcell.cn Recombinant Human Periostin PGRN cyt-524 Hystemcell.cn Recombinant Human Progranulin Pleiotrophin cyt-451 Hystemcell.cn Recombinant Human Pleiotrophin Pleiotrophin HEK cyt-198 Hystemcell.cn Recombinant Human Pleiotrophin, HEK Placental Lactogen cyt-656 Hystemcell.cn Recombinant Human Placental Lactogen bPlacental Lactogen cyt-511 Hystemcell.cn Recombinant Bovine Placental Lactogen oPlacental Lactogen cyt-512 Hystemcell.cn Recombinant Ovine Placental Lactogen cPlacental Lactogen cyt-510 Hystemcell.cn Recombinant Caprine Placental Lactogen PLGF 1 cyt-419 Hystemcell.cn Recombinant Human Placenta Growth Factor-1 PLGF 2 cyt-420 Hystemcell.cn Recombinant Human Placenta Growth Factor-2 Prolactin cyt-267 Hystemcell.cn Recombinant Human Prolactin Prolactin His cyt-493 Hystemcell.cn Recombinant Human Prolactin, His Tag mProlactin cyt-321 Hystemcell.cn Recombinant Mouse Prolactin rProlactin cyt-322 Hystemcell.cn Recombinant Rat Prolactin oProlactin cyt-240 Hystemcell.cn Recombinant Ovine Prolactin raProlactin cyt-513 Hystemcell.cn Recombinant Rabbit Prolactin Prl R, GST cyt-469 Hystemcell.cn Recombinant Human Prolactin Receptor , GST Tag Prl R cyt-595 Hystemcell.cn Recombinant Human Prolactin Receptor raPrl R cyt-268 Hystemcell.cn Recombinant Rabbit Prolactin Soluble Receptor oPrl R cyt-293 Hystemcell.cn Recombinant Ovine Prolactin Soluble Receptor bPrl R cyt-294 Hystemcell.cn Recombinant Bovine Prolactin Soluble Receptor tPrl R cyt-532 Hystemcell.cn Recombinant Raibow Trout Prolactin Soluble Receptor rPrl R cyt-533 Hystemcell.cn Recombinant Rat Prolactin Soluble Receptor oPrl A cyt-311 Hystemcell.cn Recombinant Ovine Prolactin Antagonist oPrl A Mutant cyt-705 Hystemcell.cn Recombinant Ovine Prolactin Antagonist, Mutant sCD4 cyt-304 Hystemcell.cn Recombinant Human Soluble CD4 CD4 (26-226) cyt-313 Hystemcell.cn Recombinant Human CD4 (26-226) CD4 (125-202) cyt-315 Hystemcell.cn Recombinant Human CD4 (125-202) CD4 (203-317) cyt-316 Hystemcell.cn Recombinant Human CD4 (203-317) sCD40L cyt-245 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP sCD40L His cyt-670 Hystemcell.cn Recombinant Human soluble CD40 Ligand/TRAP His Tag msCD40L cyt-472 Hystemcell.cn Recombinant Mouse soluble CD40 Ligand/TRAP SCGB1A1 cyt-743 Hystemcell.cn Recombinant Human Uteroglobin mSCGB1A1 cyt-746 Hystemcell.cn Recombinant Mouse Uteroglobin SHH cyt-676 Hystemcell.cn Recombinant Human Sonic HedgeHog SHH, His cyt-717 Hystemcell.cn Recombinant Human Sonic HedgeHog, His Tag mSHH cyt-597 Hystemcell.cn Recombinant Mouse Sonic HedgeHog mSHH, His cyt-711 Hystemcell.cn Recombinant Mouse Sonic HedgeHog, His Tag DHH cyt-467 Hystemcell.cn Recombinant Human Desert HedgeHog DHH (C23II) cyt-362 Hystemcell.cn Recombinant Human Desert HedgeHog (C23II) sRANKL cyt-334 Hystemcell.cn Recombinant Human Soluble RANK Ligand sRANKL His cyt-692 Hystemcell.cn Recombinant Human Soluble RANK Ligand, His Tag sRANKL GST cyt-631 Hystemcell.cn Recombinant Human Soluble RANK Ligand, GST Tag msRANKL cyt-320 Hystemcell.cn Recombinant Mouse Soluble RANK Ligand sRANK Receptor cyt-734 Hystemcell.cn Recombinant Human Soluble RANK Receptor mRELM a cyt-309 Hystemcell.cn Recombinant Mouse RELM-alpha mRELM a His cyt-453 Hystemcell.cn Recombinant Mouse RELM-alpha His Tag RELM b cyt-454 Hystemcell.cn Recombinant Human RELM-beta mRELM b cyt-413 Hystemcell.cn Recombinant Mouse RELM-beta mRELM g cyt-455 Hystemcell.cn Recombinant Mouse RELM-Gamma Resistin cyt-456 Hystemcell.cn Recombinant Human Resistin Resistin His cyt-256 Hystemcell.cn Recombinant Human Resistin, His Tag Resistin Mutant cyt-585 Hystemcell.cn Recombinant Human Resistin Mutant mResistin cyt-457 Hystemcell.cn Recombinant Mouse Resistin rResistin cyt-458 Hystemcell.cn Recombinant Rat Resistin RBP1 cyt-122 Hystemcell.cn Recombinant Human Retinol Binding Protein-1 RBP4 cyt-535 Hystemcell.cn Recombinant Human Retinol Binding Protein-4 RBP4 His cyt-555 Hystemcell.cn Recombinant Human Retinol Binding Protein-4 His Tag RBP5 cyt-650 Hystemcell.cn Recombinant Human Retinol Binding Protein-5 RBP7 cyt-023 Hystemcell.cn Recombinant Human Retinol Binding Protein-7 SAA1 cyt-675 Hystemcell.cn Recombinant Human Serum Amyloid A (APO-SAA1) rmSAA1 cyt-719 Hystemcell.cn Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1) SAA4 cyt-002 Hystemcell.cn Recombinant Human Serum Amyloid A4 SCF cyt-255 Hystemcell.cn Recombinant Human Stem Cell Factor mSCF cyt-275 Hystemcell.cn Recombinant Mouse Stem Cell Factor rSCF cyt-323 Hystemcell.cn Recombinant Rat Stem Cell Factor SCF Sf9 cyt-421 Hystemcell.cn Recombinant Human Stem Cell Factor, Sf9 SCF HEK cyt-111 Hystemcell.cn Recombinant Human Stem Cell Factor, HEK k9SCF cyt-194 Hystemcell.cn Recombinant Canine Stem Cell Factor SF20 cyt-622 Hystemcell.cn Recombinant Human Chromosome 19 Open Reading Frame 10 mSF20 cyt-678 Hystemcell.cn Recombinant Mouse Chromosome 19 Open Reading Frame 10 SPP1 cyt-635 Hystemcell.cn Recombinant Human Osteopontin SPP1 HEK cyt-047 Hystemcell.cn Recombinant Human Osteopontin, HEK TACI cyt-032 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 13B TAFA2 cyt-118 Hystemcell.cn Recombinant Human Family with Sequence Similarity 19 Member A2 TDGF1 cyt-712 Hystemcell.cn Recombinant Human Teratocarcinoma-Derived Growth Factor 1 TFF1 cyt-586 Hystemcell.cn Recombinant Human Trefoil Factor-1 TFF1 His cyt-610 Hystemcell.cn Recombinant Human Trefoil Factor-1 His Tag TFF2 cyt-612 Hystemcell.cn Recombinant Human Trefoil Factor-2 TFF2 His cyt-611 Hystemcell.cn Recombinant Human Trefoil Factor-2 His Tag TFF3 cyt-005 Hystemcell.cn Recombinant Human Trefoil Factor-3 TFF3 His cyt-616 Hystemcell.cn Recombinant Human Trefoil Factor-3 His Tag TGF b 1 cyt-716 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 TGF b 1 cyt-561 Human Transforming Growth Factor-Beta 1 TGF b 1 GST cyt-473 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1, GST tag TGF b 1 His cyt-672 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 His Tag TGF b 1 (113 a.a.) cyt-679 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.) TGF b 2 cyt-441 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2 TGF b 2 HEK cyt-112 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 2, HEK TGF b 3 cyt-368 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3 TGF b 3 CHO cyt-685 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, CHO TGF b 3 Plant cyt-588 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, Plant TGF b 3 HEK cyt-113 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3, HEK TGF b 3 (207 a.a.) cyt-319 Hystemcell.cn Recombinant Human Transforming Growth Factor-Beta 3 (644-850) mTGF b 3 cyt-143 Hystemcell.cn Recombinant Mouse Transforming Growth Factor-Beta 3 4 1BBR cyt-463 Hystemcell.cn Recombinant Human 4-1BB Receptor 4 1BBR, His cyt-137 Hystemcell.cn Recombinant Human 4-1BB Receptor His Tag 4 1BBL cyt-149 Hystemcell.cn Recombinant Human 4-1BB Ligand 4 1BBL, His cyt-649 Hystemcell.cn Recombinant Human 4-1BB Ligand, His Tag TNF a cyt-223 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha TNF a His cyt-494 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, His Tag TNF a HEK cyt-114 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, HEK mTNF a cyt-252 Hystemcell.cn Recombinant Mouse Tumor Necrosis Factor-alpha rTNF a cyt-393 Hystemcell.cn Recombinant Rat Tumor Necrosis Factor-alpha rpTNF a cyt-405 Hystemcell.cn Recombinant Porcine Tumor Necrosis Factor-alpha raTNF a cyt-008 Hystemcell.cn Recombinant Rabbit Tumor Necrosis Factor-alpha rCaTNF a cyt-140 Hystemcell.cn Recombinant Canine Tumor Necrosis Factor-alpha rmTNF a cyt-737 Hystemcell.cn Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha TNF a Mutant cyt-384 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-alpha, Mutant TNF b cyt-224 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta TNF b His cyt-495 Hystemcell.cn Recombinant Human Tumor Necrosis Factor-beta, His Tag TNFR2 cyt-674 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type 2 TNFR2 Fc cyt-422 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein TNFRSF17 cyt-598 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen TNFRSF17, His cyt-190 Hystemcell.cn Recombinant Human B-Cell Maturation Antigen, His Tag TNFR cyt-707 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor TNFR His cyt-673 Hystemcell.cn Recombinant Human Tumor Necrosis Factor Receptor Type His Tag TNFSF12 cyt-699 Hystemcell.cn Recombinant Human TNF Ligand Superfamily Member 12 TNFRSF10B cyt-069 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 10B TNFRSF12A cyt-043 Hystemcell.cn Recombinant Human TNF Ligand Receptor Superfamily Member 12A TSLP cyt-572 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin TSLPR cyt-742 Hystemcell.cn Recombinant Human Thymic Stromal Lymphopoietin Receptor TPO cyt-302 Hystemcell.cn Recombinant Human Thrombopoietin TPO CHO cyt-462 Hystemcell.cn Recombinant Human Thrombopoietin, CHO TPO HEK cyt-115 Hystemcell.cn Recombinant Human Thrombopoietin, HEK mTPO cyt-346 Hystemcell.cn Recombinant Mouse Thrombopoietin TRAIL cyt-443 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L TRAIL (114-281 a.a.) cyt-546 Hystemcell.cn Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281) ULBP1 cyt-166 Hystemcell.cn Recombinant Human UL16 Binding Protein 1 Vaspin cyt-459 Hystemcell.cn Recombinant Human Vaspin VEGF cyt-241 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor VEGF His cyt-496 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, His Tag VEGF CHO cyt-260 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, CHO VEGF HEK cyt-225 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, HEK VEGF Yeast cyt-577 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor, Yeast VEGF (121a.a.) cyt-343 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121) VEGF (121a.a.) Sf9 cyt-200 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), Sf9 VEGF (121a.a.) His cyt-619 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), His Tag VEGF (121a.a.) HEK cyt-116 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor (121), HEK rmVEGF cyt-336 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor mVEGF Sf9 cyt-226 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor-Sf9 rmVEGF (121a.a.) cyt-574 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor (121) rmVEGF His cyt-680 Hystemcell.cn Recombinant Mouse Vascular Endothelial Growth Factor, His Tag rVEGF cyt-392 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor VEGFB cyt-628 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor B VEGF C cyt-527 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor Related Protein rVEGF C cyt-262 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor Related Protein rVEGF C (152a.a.) cyt-284 Hystemcell.cn Recombinant Rat Vascular Endothelial Growth Factor-C (152) VEGF D cyt-045 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Factor D VEGF E (Orf Virus) cyt-263 Hystemcell.cn Recombinant Vascular Endothelial Growth Factor-E (Orf Virus) VEGI cyt-517 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor VEGI His cyt-589 Hystemcell.cn Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag Visfatin cyt-318 Hystemcell.cn Recombinant Human Visfatin Visfatin His cyt-563 Hystemcell.cn Recombinant Human Visfatin, His Tag mVisfatin cyt-447 Hystemcell.cn Recombinant Mouse Visfatin 重慶市華雅干細胞技術有限公司 ： |
設為主頁
加入收藏
聯系我們
點擊放大
